PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.13129s0302.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 339aa    MW: 37517.1 Da    PI: 8.0518
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.13129s0302.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.3e-18187241256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rk+ +++k+q   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Bostr.13129s0302.1.p 187 RKKLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTK 241
                           678899***********************************************98 PP

2HD-ZIP_I/II128.43e-41187276191
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rlsk+q+++LE+sF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr 
  Bostr.13129s0302.1.p 187 RKKLRLSKDQSAFLEDSFKEHSTLNPKQKIALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLTEENRRLQKEVKELR- 274
                           69*************************************************************************************9. PP

           HD-ZIP_I/II  90 el 91 
                           +l
  Bostr.13129s0302.1.p 275 TL 276
                           55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-17166241IPR009057Homeodomain-like
SuperFamilySSF466894.18E-18179244IPR009057Homeodomain-like
PROSITE profilePS5007116.989183243IPR001356Homeobox domain
SMARTSM003891.5E-16185247IPR001356Homeobox domain
CDDcd000867.75E-16187244No hitNo description
PfamPF000462.3E-15187241IPR001356Homeobox domain
PROSITE patternPS000270218241IPR017970Homeobox, conserved site
PfamPF021837.1E-11243276IPR003106Leucine zipper, homeobox-associated
SMARTSM003407.2E-26243286IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MELALSLGDN TKKQFSFLEK HSKINNPSAS STSTSDKDLG FCMGLDVAFG GHRSLSSSSS  60
PSVEDAKKKS APRANNPDGF RVSSSVDPPL QLQLHFPNWL PENGRQGGPM LSGVAMVVAE  120
EEEEEEAVPS MSVSPPNSVT SSFQLDFGIK SYGYEISRNK RDIDDEVERS ASRASNEDND  180
DENGSTRKKL RLSKDQSAFL EDSFKEHSTL NPKQKIALAK QLNLRPRQVE VWFQNRRART  240
KLKQTEVDCE YLKRCCESLT EENRRLQKEV KELRTLKTST PFYMQLPATT LTMCPSCERV  300
ATSATQPATS ASQNLGLSTS LLHCPLIPVK PRPAKQVS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1185191TRKKLRL
2235243RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4311820.0AJ431182.2 Arabidopsis thaliana mRNA for homeodomain-leucine zipper protein HAT14 (hat14 gene).
GenBankAK2274230.0AK227423.1 Arabidopsis thaliana mRNA for homeobox protein, complete cds, clone: RAFL14-07-H22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010452611.10.0PREDICTED: homeobox-leucine zipper protein HAT14
SwissprotP466650.0HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLR0FFM30.0R0FFM3_9BRAS; Uncharacterized protein
STRINGscaffold_600659.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49282852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-180homeobox from Arabidopsis thaliana